PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10012721m
Common NameEUTSA_v10012721mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SBP
Protein Properties Length: 804aa    MW: 89833.6 Da    PI: 7.0883
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10012721mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP117.28.2e-37143219177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +Cqv+gCead+se+k yh+rh+vC  +++a++v+++g+++r+CqqC++fh ls+fDe+krsCrr+L++hn+rr++k 
  Thhalv10012721m 143 RCQVPGCEADISELKGYHKRHRVCLRCANASSVVLDGENKRYCQQCGKFHVLSDFDEGKRSCRRKLERHNNRRKRKP 219
                      6************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.8E-29137205IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.607141218IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.84E-34142222IPR004333Transcription factor, SBP-box
PfamPF031101.5E-27144217IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 804 aa     Download sequence    Send to blast
MSSMSQSPSA PEMEIQPPTL VNDDPSTYSS AMWDWGDLLD FTADDRLLVS FDSETPFSPV  60
PPPPPPPPPP MIATQPPVES ESYPSPDESG SGSDRVRKRD PRLICSNFLE GMLPCSCPEL  120
DQKLEEAELP KKKRVRGGSG VARCQVPGCE ADISELKGYH KRHRVCLRCA NASSVVLDGE  180
NKRYCQQCGK FHVLSDFDEG KRSCRRKLER HNNRRKRKPV DKGGVAPKQQ QVSSQNDNSV  240
IDVDDAKDNT YSSDQRAEQE ASMNFEDRHI PAQGSVPFTH SINADNFVSV TGSGEAQPEE  300
GINDTKFELS PSCGENKSAY STVCPTGRIS FKLYDWNPAE FPRRLRHQIF QWLATMPVEL  360
EGYIRPGCTI LTVFIAMPEI MWAKLSKDPV AYLDEFILKP GKMLFGRGSM TVYLNNMIFR  420
LMKGGTTLKR VDVKLESPKL QFVYPTCFEA GKPIELVVCG HNLLQPKCRF LVSFSGKYLP  480
HNYSVLPAPG QDGKRSCDNK FYKINIVNSD PNLFGPAFVE VENESGLSNF IPLIIGDKAI  540
CSEMKLIEQK FNATLFPEGQ GVTACCSLTC CCRDFEERQS TFTGLLLDIA WSVKMPSSEC  600
TEQTVNRCQI KRYNRVLNYL IQSNSASILG NVLHNLEKLV KKMDPDSLVH CTCDCDVRLL  660
HENMNVARKQ QSYEDSKLKP GISGCCCESS FQKDIPSRMF NYNQDPEAGL DCKERLQAAS  720
PDTGGKETDP LINKEVVMDV NDMGVWPRKS CIPIHKAKTF RSHQTVFLIA TFVVCFAVCA  780
VLYHPNKVTQ LAVAIRTRLA HNV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A3e-49141226388squamosa promoter binding protein-like 7
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3535520.0AK353552.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-52-E05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006400438.10.0hypothetical protein EUTSA_v10012721mg
SwissprotQ8S9G80.0SPL7_ARATH; Squamosa promoter-binding-like protein 7
TrEMBLE4MYF50.0E4MYF5_EUTHA; mRNA, clone: RTFL01-52-E05
TrEMBLV4N8650.0V4N865_EUTSA; Uncharacterized protein
STRINGscaffold_601959.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63582644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.10.0squamosa promoter binding protein-like 7